Domain profile · Jun–Aug 2026Status · Live

pineschamber.com↗

The Greater Fire Island Pines Chamber of Commerce

#7,046,391Link-graph rank

Top 5.9%of 119.7M domains

PageRank #10,990,408By links pointing at it

2 hostsSubdomains in the link graph

About

The Pines Chamber of Commerce consists of over forty local businesses to serve the residents and visitors of the Fire Island Pines Community.

Technologies

Content & CMS · 2Commerce & payments · 2Frontend · 2Infrastructure & security · 2

WebsiteBuilderWixSirvoyWix eCommerceHTTP/3ReactCloudflareHSTS

Site details

Website	pineschamber.com ↗
Facebook	GreaterFireIslandPinesChamberOfCommerce ↗
Site language	English
Last read	23 Sep 2026

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
7046388	tampaflcriminaldefenselawyers.comtampaflcriminaldefenselawyers.com	Tampa Criminal Defense Resources	Google AnalyticsGoogle Tag Manager+3+4	American English
7046390	marineacofcentralflorida.commarineacofcentralflorida.com	Marine AC, refrigeration & watermaker install & repair for yachts, cruisers & sailboats. Serving Florida since 2005. Call now to schedule your service.	Google AnalyticsGoogle Tag Manager+8+9	American English
7046395	womensfundsb.orgwomensfundsb.org	The Women's Fund of Santa Barbara is a volunteer-led collective donor organization dedicated to empowering women and addressing the critical needs of women, children, and families in south Santa Barbara County through impactful grants and community engagement.	Google AnalyticsGoogle Tag Manager+2+3	English
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
7046396	cronicas-upch.pecronicas-upch.pe	Bot Verification	reCAPTCHA