Domain profile · Jun–Aug 2026Status · Live

marineacofcentralflorida.com↗

Marine AC, Refrigeration & Watermaker Services | Marine AC of Central Florida

#7,046,390Link-graph rank

Top 5.9%of 119.7M domains

PageRank #773,881By links pointing at it

2 hostsSubdomains in the link graph

About

Marine AC, refrigeration & watermaker install & repair for yachts, cruisers & sailboats. Serving Florida since 2005. Call now to schedule your service.

Technologies

Marketing & analytics · 3Content & CMS · 1Commerce & payments · 1Frontend · 2Backend & data · 3

Google AnalyticsGoogle Tag ManagerYoast SEOWordPressWooCommercejQueryjQuery MigrateMySQLNginxPHP

Site details

Website	marineacofcentralflorida.com ↗
Phone	321-784-2400
Site language	American English
Last read	23 Sep 2026

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
7046388	tampaflcriminaldefenselawyers.comtampaflcriminaldefenselawyers.com	Tampa Criminal Defense Resources	Google AnalyticsGoogle Tag Manager+3+4	American English
7046391	pineschamber.compineschamber.com	The Pines Chamber of Commerce consists of over forty local businesses to serve the residents and visitors of the Fire Island Pines Community.	WebsiteBuilderWix+6+7	English
7046395	womensfundsb.orgwomensfundsb.org	The Women's Fund of Santa Barbara is a volunteer-led collective donor organization dedicated to empowering women and addressing the critical needs of women, children, and families in south Santa Barbara County through impactful grants and community engagement.	Google AnalyticsGoogle Tag Manager+2+3	English
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English

Is this your site? Request removal of the marineacofcentralflorida.com page.