Domain profile · Jun–Aug 2026Status · Live

vitalplanet.com↗

Vital Planet - Premium Probiotics & Digestive Health Supplements – Vital Planet Shop

#13,720,336Link-graph rank

Top 11.5%of 119.7M domains

PageRank #5,179,986By links pointing at it

4 hostsSubdomains in the link graph

About

Premium probiotics & digestive health supplements by Brenda Watson. As seen on PBS. Science-backed formulas for optimal gut health & immune support.

Technologies

Marketing & analytics · 1Commerce & payments · 1Frontend · 1Infrastructure & security · 2

Google Tag ManagerShopifyHTTP/3CloudflareHSTS

Site details

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
13720332	custompaintinginc.comcustompaintinginc.com	Custom Painting, Inc., premium service since 1982, is a full service painting company and custom moldings installer. Call for an estimate at 1-866-969-3724	WordPressBootstrap+6+7	American English
13720334	ruleinvestmentmedia.comruleinvestmentmedia.com	Let Rick Rule and his team help you navigate the challenging world of resource investments.	Google AnalyticsGoogle Tag Manager+10+11
13720335	thehellohi.comthehellohi.com	Discover The Hello Hi, a local bar in Sioux Falls offering tropical-themed cocktails and a lively atmosphere. Join us for great drinks and summer vibes any day of the week.	SquarespaceSquarespace Commerce+3+4	American English
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
13720337	thinkpharmacyfirst.healththinkpharmacyfirst.health	Pharmacies across the North East and North Cumbria can offer advice and treatment for many common conditions. There’s no need for a GP appointment – just ' Think Pharmacy First ' Pop along to...	WeeblyjQuery+5+6	English
13720340	browniehuys.nlbrowniehuys.nl	a box of happiness	Google AnalyticsGoogle Tag Manager+9+10	Dutch (Netherlands)
13720341	friedhelmflamme.orgfriedhelmflamme.org	Friedhelm Flamme \| Konzertorganist	Twenty TwelveWordPress+7+8	German