Domain profile · Jun–Aug 2026Status · Live

tossos.de↗

Ledertaschen Handgefertigt Aus Italien | Tossos

#15,252,130Link-graph rank

Top 12.7%of 119.7M domains

PageRank #19,046,000By links pointing at it

2 hostsSubdomains in the link graph

About

Premium Ledertaschen handgefertigt aus Italien bestehend aus Reisegepäck, Umhängetaschen und Aktentaschen, aus toskanischem Kalbsleder.

Technologies

Marketing & analytics · 1Frontend · 1Infrastructure & security · 2

Facebook PixelHTTP/3CloudflareHSTS

Site details

Website	tossos.de ↗
Last read	30 Sep 2026

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
15252126	indykarchitects.com.auindykarchitects.com.au	Indyk architects, awarded and respected, strive for innovation and excellence in all their works from residential to commercial to community projects.	Google AnalyticsGoogle Tag Manager+5+6	American English
15252128	badgerkartclub.combadgerkartclub.com	Home - Badger Kart Club	Yoast SEODivi+4+5	American English
15252129	flatirondomain.comflatirondomain.com	Flatiron Domain’s studio, one, two, & three bedroom apartments provide all of the style and comfort you deserve. We invite you to come see what the buzz is all about.	Google Tag ManagerAdobe Fonts+4+5	English
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
15252131	versdiagnose.deversdiagnose.de	vers.diagnose ist die digitale online Risikoprüfung! Erhalten Sie mit vers.diagnose anonym, in Echtzeit online eine verbindliche Einschätzung zu Absicherungsformen biometrischer Risiken.	NginxHSTS+1	German (Germany)
15252132	intertown.co.ilintertown.co.il	עמוד הבית - אינטרטאון - מערכות gis‏ וסקרים גאוגרפיים לרשות המקומית מציעה מגגון רחב של עמוד הבית. הכנסו לאתר לפרטים נוספים על עמוד הבית	Google Tag ManagerApache HTTP Server+1+2
15252134	metaversewerkplaats.nlmetaversewerkplaats.nl	Metaverse Werkplaats	WordPressjQuery+4+5	American English