Domain profile · Jun–Aug 2026Status · Live

tiggocare.com↗

Award Winning Home Care Available Across London

#14,826,288Link-graph rank

Top 12.4%of 119.7M domains

PageRank #10,165,130By links pointing at it

2 hostsSubdomains in the link graph

About

Tiggo Care offers award-winning home care services tailored to your specific needs. Remain in the comfort of your own home and get the care you need.

Technologies

Marketing & analytics · 2Frontend · 1Infrastructure & security · 2

Google AnalyticsGoogle Tag ManagerHTTP/3CloudflareHSTS

Site details

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
14826286	santabarbaradivers.comsantabarbaradivers.com	Guided scuba diving in Santa Barbara & Ventura county. We offer all level courses and provide one on one instruction for maximum learning, fun and safety	GoDaddy Website BuilderHSTS+1	American English
14826287	sereneinterio.comsereneinterio.com	Serene Interio – Interior Designers in Hyderabad. We create elegant, affordable spaces tailored to your style. Get in touch for a free consultation today!	Google Tag ManagerYoast SEO+6+7	American English
14826289	vixenbeauty.comvixenbeauty.com	Vixen Beaty offers permanent jewelry supplies and training, non-surgical bbl training and supplies, and hyaluron supplies and trainings and services. Learn hyaluron filler and body sculpting from Vixen Beauty at your own pace or in-person.	PrivyWebsiteBuilder+7+8	English
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
14826291	hyconnect.dehyconnect.de	Hyconnect GmbH – We know how to connect.	ElementorWordPress+9+10	German (Germany)
14826292	plasticfreetakeaway.hkplasticfreetakeaway.hk	「咪嘥盒食店」計劃	Google AnalyticsGoogle Tag Manager+6+7