Domain profile · Jun–Aug 2026Status · Live

theoasislagos.org↗

The Oasis Lagos – The Pleasant Place

#12,479,124Link-graph rank

Top 10.4%of 119.7M domains

PageRank #63,718,242By links pointing at it

2 hostsSubdomains in the link graph

About

Event closed.19, 239 A.M Special Sunday Service Event DetailsEvent closed.20,20236PM Oasis International Conference 2023 Event Details Welcome The Oasis Welcome to RCCG, The Oasis Lagos, we’re a house of refreshment for a generation of young people hungry and thirsty for God. We’re the youth arm of RCCG The King’s Court, LP39, located at 3, Keystone

Technologies

Content & CMS · 1Frontend · 3Backend & data · 3Infrastructure & security · 1

WordPressBootstrapjQueryjQuery MigrateLiteSpeedMySQLPHPLiteSpeed Cache

Site details

Website	theoasislagos.org ↗
X	@theoasislagos ↗
Facebook	theoasislagos ↗
Instagram	@theoasislagos ↗
Site language	American English
Last read	30 Sep 2026

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
12479120	sweetdefiance.orgsweetdefiance.org	Sweet Defiance Podcast	BootstrapjQuery+8+9	English
12479123	theglobalfemalecivilityleadershipinstitute.orgtheglobalfemalecivilityleadershipinstitute.org → viiicnif2025.com	Nenektogel4d menjadi portal berita hotnews hongkong hari ini dengan kabar terbaru seputar hongkong serta informasi nenektogel yang diperbarui mengikuti perkembangan terkini.	Google AnalyticsGoogle Tag Manager+6+7	Indonesian
12479125	theoneopendoor.orgtheoneopendoor.org	The Practice of Zen Buddhist Meditation is work and realize the suffering from within. This is the way that leads through the one open door to true happiness.	All in One SEOAll in One SEO Pack+16+17	English
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
12479126	thewayitisnow.orgthewayitisnow.org	We often underestimate how much our mindset shapes the way we respond when life really matters. Your perspective sets the tone for whether you see challenges as roa…	BootstrapHTTP/3+5+6	English
12479127	thewholepastor.orgthewholepastor.org	The Whole Pastor	SquarespaceSquarespace Commerce+4+5	American English
12479129	tworiverspca.orgtworiverspca.org	TWO RIVERS PRESBYTERIAN CHURCH Sundays at 9am in Park Circle	SquarespaceSquarespace Commerce+3+4	American English

Is this your site? Request removal of the theoasislagos.org page.