Domain profile · Jun–Aug 2026Status · Live

republikamagazine.com↗

Home - Repúblika

#3,347,600Link-graph rank

Top 2.8%of 119.7M domains

PageRank #31,132,756By links pointing at it

1 hostSubdomains in the link graph

About

Documenting dictatorship in Fiji: 2012–2014 Repúblika was published as a printed magazine in Fiji from 2012 until 2014, in the middle of a period when freedom of expression and of the press were severely repressed. Despite the challenges and pressure from the regime led by military commander Voreqe Bainimarama, Repúblika remained a conscience check on

Technologies

Marketing & analytics · 2Content & CMS · 1Backend & data · 2

All in One SEOAll in One SEO PackWordPressMySQLPHP

Site details

Website	republikamagazine.com ↗
Site language	British English
Last read	21 Sep 2026

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
3347595	miriampiilonen.commiriampiilonen.com	Miriam Piilonen	jQuerycdnjs+2+3
3347598	ontrackkarting.comontrackkarting.com → gotime.us	GoTime \| Indoor Karting, Arcade and Food	Google AnalyticsGoogle Tag Manager+6+7	American English
3347599	poetrybycharlescfinn.compoetrybycharlescfinn.com	Official site and blog of Charles C. Finn, author of Please Hear What I Am Not Saying. Thoughts on spirituality, nature, parenting, relationships, counseling.	ShopifyBootstrap+4+5	English
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
3347601	specialtyfinanceservicinginc.comspecialtyfinanceservicinginc.com	Explore All About Latest Business news with Specialty Finance Servicing Inc: in-depth articles, how-tos, and the latest developments, all in one place.	WordPressjQuery+4+5	American English

Is this your site? Request removal of the republikamagazine.com page.