Domain profile · Jun–Aug 2026Status · Live

ludman.net↗

Home - Ludman Industries | #1 Best Roll Compaction OEM

#14,826,294Link-graph rank

Top 12.4%of 119.7M domains

PageRank #6,340,191By links pointing at it

2 hostsSubdomains in the link graph

About

Ludman Industries is the ultimate partner in processing technology, supplying hundreds of machines to material processors throughout the world.

Technologies

Content & CMS · 1Backend & data · 3Infrastructure & security · 1

WordPressLiteSpeedMySQLPHPLiteSpeed Cache

Site details

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
14826289	vixenbeauty.comvixenbeauty.com	Vixen Beaty offers permanent jewelry supplies and training, non-surgical bbl training and supplies, and hyaluron supplies and trainings and services. Learn hyaluron filler and body sculpting from Vixen Beauty at your own pace or in-person.	PrivyWebsiteBuilder+7+8	English
14826291	hyconnect.dehyconnect.de	Hyconnect GmbH – We know how to connect.	ElementorWordPress+9+10	German (Germany)
14826292	plasticfreetakeaway.hkplasticfreetakeaway.hk	「咪嘥盒食店」計劃	Google AnalyticsGoogle Tag Manager+6+7
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
14826297	nawierzchnieasfaltowe.plnawierzchnieasfaltowe.pl	Czasopismo wydawane przez Polskie Stowarzyszenie Wykonawców Nawierzchni Asfaltowych, prezentujące najnowsze badania naukowe, rozwiązania materiałowo-techniczne oraz przykłady ciekawych inwestycji w kontekście budowy, utrzymania oraz doskonalenia nawierzchni asfaltowych.	DiviWordPress+5+6	Polish (Poland)
14826298	rocio.com.brrocio.com.br	Viação Rocio \| Transporte Coletivo	FitVids.JSWordPress+9+10	Brazilian Portuguese
14826299	1net.by1net.by	Интернет-провайдер 1Net. Безлимитный интернет и IPTV. Установка и продажа видеонаблюдения, домофонов, обслуживание информационных систем.	Google Tag ManagerYoast SEO+6+7	Russian (Russia)