Domain profile · Jun–Aug 2026Status · Live

24hourbondsman.com↗

Bail Bondsman Greensboro | All American Bail Bonds

#19,175,208Link-graph rank

Top 16.0%of 119.7M domains

PageRank #56,432,365By links pointing at it

1 hostSubdomains in the link graph

About

If you or a loved one has been arrested & needs to post bail, get in touch with All American Bail Bonds. We are Greensboro, NC based. Available 24*7.

Technologies

Marketing & analytics · 1Content & CMS · 1Frontend · 2Backend & data · 3

Google Tag ManagerWordPressjQueryjQuery MigrateLiteSpeedMySQLPHP

Site details

Website	24hourbondsman.com ↗
Phone	336-814-8130
Facebook	allamericanbailbondsllc ↗
Instagram	@allamericanbailbonds ↗
YouTube	Channel ↗
Site language	American English
Last read	1 Oct 2026

Similar sites

Sites ranked next to it

Rank	Site	Description	Technologies	Language
19175204	hopefirst.orghopefirst.org	Think you might be pregnant? Access services, caring support, and truthful answers to explore your options and make an empowered choice. Contact us.	Google AnalyticsGoogle Tag Manager+6+7	American English
19175205	filmmakersacademy.pagefilmmakersacademy.page	@filmmakersacademy: Advanced AI Animatic Workflow, Spotlight Coaching Pete Zuccarini - Underwater Cinematographer. Products: The Look Of The Odyssey.	HTTP/3Next.js+4+5	English
19175206	blott.plblott.pl	Blott Sp. z o.o. non profit – Blott Spółka z ograniczoną odpowiedzialnością non profit	WordPressWordPress Block Editor+6+7	Polish (Poland)
Ad	Serpex Search APIserpex.dev	The fast, affordable search API for AI & data projects.	Google AnalyticsNext.js	English
19175207	focis.co.ukfocis.co.uk	Focis design, develop, and deploy bespoke legal software solutions – enabling your firm to connect your workflow and clients with ease. Book a consultation today.	NginxHSTS+1	English
19175211	partyverhuurbrabant.compartyverhuurbrabant.com	Bij Partyverhuur Brabant vindt u voor elke gelegenheid exact wat u nodig heeft, of u nu een groots feest of een belangrijk evenement organiseert. ✅ Top kwaliteit ✅ Scherpe prijzen.	Google Tag ManagerWordPress+8+9	Dutch (Netherlands)
19175212	tealemoo.comtealemoo.com	بوابة الأخبار الأكاديمية العراقية الأولى. تابع نشاطات أكثر من 20 جامعة وكلية عراقية: المؤتمرات العلمية، التصنيفات العالمية، إنجازات أعضاء هيئة التدريس، وأخبار الكليات الحكومية والأهلية. تحديث يومي.	Google AdSenseGoogle Analytics+8+9	Arabic

Is this your site? Request removal of the 24hourbondsman.com page.